Septin 3 (SEPT3) (NM_019106) Human Mass Spec Standard

CAT#: PH315714

SEPT3 MS Standard C13 and N15-labeled recombinant protein (NP_061979)

Product Images

Coomassie blue staining of purified SEPTIN3 protein (Cat# TP315714). The protein was produced from HEK293T cells transfected with SEPTIN3 cDNA clone (Cat# RC215714) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215714
• Predicted MW: 39.9 kDa
• Protein Sequence:
  Sequence Link

  >RC215714 representing NM_019106
  Red=Cloning site Green=Tags(s)
  
  MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQS
  GLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWE
  PIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKAD
  TMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGR
  KTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPVSVDTEESHDSNP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061979
• RefSeq Size: 4656
• RefSeq ORF: 1050
• Synonyms: bK250D10.3; SEP3; SEPT3
• Locus ID: 55964
• UniProt ID: Q9UH03
• Cytogenetics: 22q13.2
• Summary: This gene belongs to the septin family of GTPases. Members of this family are required for cytokinesis. Expression is upregulated by retinoic acid in a human teratocarcinoma cell line. The specific function of this gene has not been determined. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, May 2018]