QK1 (QKI) (NM_206855) Human Mass Spec Standard

CAT#: PH315788

QKI MS Standard C13 and N15-labeled recombinant protein (NP_996737)

Product Images

Coomassie blue staining of purified QKI protein (Cat# TP315788). The protein was produced from HEK293T cells transfected with QKI cDNA clone (Cat# RC215788) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215788
• Predicted MW: 35.1 kDa
• Protein Sequence:
  Sequence Link

  >RC215788 representing NM_206855
  Red=Cloning site Green=Tags(s)
  
  MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSA
  ELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRG
  KPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIK
  SPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPE
  AGLIYTPYEYPYTLAPATSILEYPIEPSGVLGKFFSPWG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996737
• RefSeq Size: 7919
• RefSeq ORF: 957
• Synonyms: Hqk; hqkI; QK; QK1; QK3
• Locus ID: 9444
• UniProt ID: Q96PU8, Q8WY44
• Cytogenetics: 6q26
• Summary: The protein encoded by this gene is an RNA-binding protein that regulates pre-mRNA splicing, export of mRNAs from the nucleus, protein translation, and mRNA stability. The encoded protein is involved in myelinization and oligodendrocyte differentiation and may play a role in schizophrenia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]