SM22 alpha (TAGLN) (NM_003186) Human Mass Spec Standard
CAT#: PH315789
TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_003177)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC215789 |
| Predicted MW | 22.4 kDa |
| Protein Sequence |
>RC215789 representing NM_003186
Red=Cloning site Green=Tags(s) MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_003177 |
| RefSeq Size | 1177 |
| RefSeq ORF | 603 |
| Synonyms | SM22; SM22-alpha; SMCC; TAGLN1; WS3-10 |
| Locus ID | 6876 |
| UniProt ID | Q01995, Q5U0D2 |
| Cytogenetics | 11q23.3 |
| Summary | 'This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization. [provided by RefSeq, Aug 2017]' |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401104 | TAGLN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC424369 | TAGLN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401104 | Transient overexpression lysate of transgelin (TAGLN), transcript variant 2 |
USD 436.00 |
|
| LY424369 | Transient overexpression lysate of transgelin (TAGLN), transcript variant 1 |
USD 436.00 |
|
| PH302448 | TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_001001522) |
USD 2,055.00 |
|
| TP302448 | Recombinant protein of human transgelin (TAGLN), transcript variant 1 |
USD 823.00 |
|
| TP315789 | Recombinant protein of human transgelin (TAGLN), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China