STAT3 (NM_139276) Human Mass Spec Standard
CAT#: PH315836
STAT3 MS Standard C13 and N15-labeled recombinant protein (NP_644805)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215836 |
Predicted MW | 87.9 kDa |
Protein Sequence |
>RC215836 representing NM_139276
Red=Cloning site Green=Tags(s) MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSR FLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEK QQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTAL DQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQ IKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVR LLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNV NFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFS FWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISG KTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG SAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_644805 |
RefSeq Size | 4978 |
RefSeq ORF | 2310 |
Synonyms | ADMIO; ADMIO1; APRF; HIES |
Locus ID | 6774 |
UniProt ID | P40763 |
Cytogenetics | 17q21.2 |
Summary | 'The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome. [provided by RefSeq, Aug 2020]' |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Chemokine signaling pathway, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403728 | STAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC408332 | STAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403728 | Transient overexpression lysate of signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 3 |
USD 605.00 |
|
LY408332 | Transient overexpression lysate of signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1 |
USD 396.00 |
|
PH312394 | STAT3 MS Standard C13 and N15-labeled recombinant protein (NP_998827) |
USD 2,055.00 |
|
TP312394 | Recombinant protein of human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 3 |
USD 867.00 |
|
TP315836 | Recombinant protein of human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1 |
USD 748.00 |
|
TP720889 | Purified recombinant protein of Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review