UBE2D3 (NM_181887) Human Mass Spec Standard

CAT#: PH315841

UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871616)

Product Images

Coomassie blue staining of purified UBE2D3 protein (Cat# TP315841). The protein was produced from HEK293T cells transfected with UBE2D3 cDNA clone (Cat# RC215841) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215841
• Predicted MW: 16.7 kDa
• Protein Sequence:
  Sequence Link

  >RC215841 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT
  TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE
  WTQKYAM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_871616
• RefSeq Size: 3954
• RefSeq ORF: 441
• Synonyms: E2(17)KB3; UBC4/5; UBCH5C
• Locus ID: 7323
• UniProt ID: P61077, A0A024RDH2
• Cytogenetics: 4q24
• Summary: 'The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. [provided by RefSeq, Jan 2017]'
• Protein Pathways: Ubiquitin mediated proteolysis