BHLHA15 (NM_177455) Human Mass Spec Standard

CAT#: PH315938

BHLHA15 MS Standard C13 and N15-labeled recombinant protein (NP_803238)

Product Images

Coomassie blue staining of purified BHLHA15 protein (Cat# TP315938). The protein was produced from HEK293T cells transfected with BHLHA15 cDNA clone (Cat# RC215938) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215938
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Sequence Link

  >RC215938 representing NM_177455
  Red=Cloning site Green=Tags(s)
  
  MKTKNRPPRRRAPVQDTEATPGEGTPDGSLPNPGPEPAKGLRSRPARAAARAPGEGRRRRPGPSGPGGRR
  DSSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAKNYIKSLTATILTMSSSRLP
  GLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREGT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_803238
• RefSeq Size: 588
• RefSeq ORF: 567
• Synonyms: BHLHB8; MIST1
• Locus ID: 168620
• UniProt ID: Q7RTS1
• Cytogenetics: 7q21.3
• Protein Pathways: Maturity onset diabetes of the young