POU4F2 (NM_004575) Human Mass Spec Standard

CAT#: PH315962

POU4F2 MS Standard C13 and N15-labeled recombinant protein (NP_004566)

Product Images

Coomassie blue staining of purified POU4F2 protein (Cat# TP315962). The protein was produced from HEK293T cells transfected with POU4F2 cDNA clone (Cat# RC215962) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215962
• Predicted MW: 42.9 kDa
• Protein Sequence:
  Sequence Link

  >RC215962 representing NM_004575
  Red=Cloning site Green=Tags(s)
  
  MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGGGGGGGGGGGR
  SSSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKSHHHHPPHHSPFKPD
  ATYHTMNTIPCTSAASSSSVPISHPCALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGLALGAMAGPD
  GAVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADV
  GSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKR
  TSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004566
• RefSeq Size: 3110
• RefSeq ORF: 1230
• Synonyms: Brn-3b; BRN3.2; BRN3B
• Locus ID: 5458
• UniProt ID: Q12837
• Cytogenetics: 4q31.22
• Summary: The protein encoded by this gene is a member of the POU-domain transcription factor family and may be involved in maintaining visual system neurons in the retina. The level of the encoded protein is also elevated in a majority of breast cancers, resulting in accelerated tumor growth. [provided by RefSeq, Sep 2011]
• Protein Families: Transcription Factors