KAT5 (NM_182710) Human Mass Spec Standard
CAT#: PH315979
KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_874369)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC215979 |
Predicted MW | 61.6 kDa |
Protein Sequence |
>RC215979 representing NM_182710
Red=Cloning site Green=Tags(s) MAEVVSPVPGAGRREPGEVGRARGPPVADPGVALSPQGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDI SGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLP IPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAAR RAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYF SPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLC LLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIE FSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVIS TLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_874369 |
RefSeq Size | 2335 |
RefSeq ORF | 1638 |
Synonyms | cPLA2; ESA1; HTATIP; HTATIP1; PLIP; TIP; TIP60; ZC2HC5 |
Locus ID | 10524 |
UniProt ID | Q92993 |
Cytogenetics | 11q13.1 |
Summary | The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401920 | KAT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405422 | KAT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC405423 | KAT5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY401920 | Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 2 |
USD 396.00 |
|
LY405422 | Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 3 |
USD 396.00 |
|
LY405423 | Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 1 |
USD 605.00 |
|
PH309059 | KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_006379) |
USD 2,055.00 |
|
PH310591 | KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_874368) |
USD 2,055.00 |
|
TP309059 | Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 2 |
USD 867.00 |
|
TP310591 | Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 3 |
USD 823.00 |
|
TP315979 | Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review