GSTA5 (NM_153699) Human Mass Spec Standard

CAT#: PH315990

GSTA5 MS Standard C13 and N15-labeled recombinant protein (NP_714543)

Product Images

Coomassie blue staining of purified GSTA5 protein (Cat# TP315990). The protein was produced from HEK293T cells transfected with GSTA5 cDNA clone (Cat# RC215990) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC215990
• Predicted MW: 25.5 kDa
• Protein Sequence:
  Sequence Link

  >RC215990 representing NM_153699
  Red=Cloning site Green=Tags(s)
  
  MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEIDGMKLVQTRA
  ILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAKTALVKEKIKNRYFPAFEKVL
  KSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSQRKPPMDE
  KSLEEARKIFRF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_714543
• RefSeq Size: 845
• RefSeq ORF: 666
• Synonyms: glutathione S-transferase A5; glutathione S-transferase alpha 5; glutathione transferase A5; OTTHUMP00000016610
• Locus ID: 221357
• UniProt ID: Q7RTV2
• Cytogenetics: 6p12.2
• Summary: The glutathione S-transferases (GST; EC 2.5.1.18) catalyze the conjugation of reduced glutathiones and a variety of electrophiles, including many known carcinogens and mutagens. The cytosolic GSTs belong to a large superfamily, with members located on different chromosomes. For additional information on GSTs, see GSTA1 (MIM 138359). [supplied by OMIM, Sep 2008]
• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450