IRF5 (NM_001098631) Human Mass Spec Standard
CAT#: PH316039
IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092101)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216039 |
Predicted MW | 54.8 kDa |
Protein Sequence |
>RC216039 representing NM_001098631
Red=Cloning site Green=Tags(s) MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKE TGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGA GEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEP GPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFG PISLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMF SGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001092101 |
RefSeq Size | 2741 |
RefSeq ORF | 1464 |
Synonyms | interferon regulatory factor 5; SLEB10 |
Locus ID | 3663 |
Cytogenetics | 7q32.1 |
Summary | 'This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative promoter use and alternative splicing result in multiple transcript variants, and a 30-nt indel polymorphism (SNP rs60344245) can result in loss of a 10-aa segment. [provided by RefSeq, Dec 2016]' |
Protein Families | Transcription Factors |
Protein Pathways | Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403185 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC419472 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420650 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420651 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420652 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420653 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC420654 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC426034 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426035 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426036 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426037 | IRF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403185 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 2 |
USD 325.00 |
|
LY419472 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 1 |
USD 495.00 |
|
LY420650 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 3 |
USD 495.00 |
|
LY420651 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 4 |
USD 495.00 |
|
LY420652 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 5 |
USD 495.00 |
|
LY420653 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 6 |
USD 495.00 |
|
LY420654 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 7 |
USD 495.00 |
|
LY426034 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 3 |
USD 325.00 |
|
LY426035 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 5 |
USD 325.00 |
|
LY426036 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 6 |
USD 325.00 |
|
LY426037 | Transient overexpression lysate of interferon regulatory factor 5 (IRF5), transcript variant 7 |
USD 325.00 |
|
PH300458 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_116032) |
USD 2,055.00 |
|
PH311941 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092099) |
USD 2,055.00 |
|
PH312461 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_002191) |
USD 2,055.00 |
|
PH315434 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092097) |
USD 2,055.00 |
|
PH315781 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092100) |
USD 2,055.00 |
|
PH316505 | IRF5 MS Standard C13 and N15-labeled recombinant protein (NP_001092098) |
USD 2,055.00 |
|
TP300458 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 2 |
USD 867.00 |
|
TP311941 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 5 |
USD 748.00 |
|
TP312461 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 1 |
USD 748.00 |
|
TP315434 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 3 |
USD 748.00 |
|
TP315781 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 6 |
USD 748.00 |
|
TP316039 | Purified recombinant protein of Homo sapiens interferon regulatory factor 5 (IRF5), transcript variant 7 |
USD 748.00 |
|
TP316505 | Recombinant protein of human interferon regulatory factor 5 (IRF5), transcript variant 4 |
USD 748.00 |
|
TP720880 | Purified recombinant protein of Human interferon regulatory factor 5 (IRF5), transcript variant 2 |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review