Shugoshin (SGO1) (NM_001012413) Human Mass Spec Standard
CAT#: PH316188
SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012413)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216188 |
Predicted MW | 29.3 kDa |
Protein Sequence |
>RC216188 representing NM_001012413
Red=Cloning site Green=Tags(s) MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALEN EKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQ IPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCT ASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKSMKQIQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001012413 |
RefSeq Size | 1149 |
RefSeq ORF | 774 |
Synonyms | CAID; NY-BR-85; SGO; SGOL1 |
Locus ID | 151648 |
UniProt ID | Q5FBB7 |
Cytogenetics | 3p24.3 |
Summary | The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene leads to the premature loss of centromeric cohesion, mis-segregation of sister chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of centrioles (PMID: 16582621 and PMID:18331714). Mutations in this gene have been associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101). Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015] |
Protein Pathways | Oocyte meiosis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408583 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422848 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422849 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422850 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422851 | SGOL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408583 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C2 |
USD 396.00 |
|
LY422848 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant A2 |
USD 605.00 |
|
LY422849 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B1 |
USD 396.00 |
|
LY422850 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B2 |
USD 396.00 |
|
LY422851 | Transient overexpression lysate of shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C1 |
USD 396.00 |
|
PH313965 | SGOL1 MS Standard C13 and N15-labeled recombinant protein (NP_001012411) |
USD 2,055.00 |
|
TP313965 | Recombinant protein of human shugoshin-like 1 (S. pombe) (SGOL1), transcript variant B1 |
USD 788.00 |
|
TP316188 | Recombinant protein of human shugoshin-like 1 (S. pombe) (SGOL1), transcript variant C1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review