WDR5 (NM_017588) Human Mass Spec Standard
CAT#: PH316218
WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_060058)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC216218 |
| Predicted MW | 36.4 kDa |
| Protein Sequence |
>RC216218 representing NM_017588
Red=Cloning site Green=Tags(s) MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_060058 |
| RefSeq Size | 3163 |
| RefSeq ORF | 1002 |
| Synonyms | BIG-3; CFAP89; SWD3 |
| Locus ID | 11091 |
| UniProt ID | P61964 |
| Cytogenetics | 9q34.2 |
| Summary | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402599 | WDR5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC409441 | WDR5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402599 | Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 1 |
USD 436.00 |
|
| LY409441 | Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 2 |
USD 436.00 |
|
| PH300162 | WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_438172) |
USD 2,055.00 |
|
| TP300162 | Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 2 |
USD 823.00 |
|
| TP316218 | Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China