Sialidase 3 (NEU3) (NM_006656) Human Mass Spec Standard

CAT#: PH316537

NEU3 MS Standard C13 and N15-labeled recombinant protein (NP_006647)

Product Images

Coomassie blue staining of purified NEU3 protein (Cat# TP316537). The protein was produced from HEK293T cells transfected with NEU3 cDNA clone (Cat# RC216537) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216537
• Predicted MW: 52.1 kDa
• Protein Sequence:
  Sequence Link

  >RC216537 representing NM_006656
  Red=Cloning site Green=Tags(s)
  
  MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHT
  FLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICV
  RGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIP
  AYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTP
  NRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRL
  EEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFE
  CGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006647
• RefSeq Size: 2748
• RefSeq ORF: 1383
• Synonyms: SIAL3
• Locus ID: 10825
• UniProt ID: Q9UQ49, A0A024R5N6
• Cytogenetics: 11q13.4
• Summary: This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. [provided by RefSeq, Jul 2008]
• Protein Pathways: Other glycan degradation, Sphingolipid metabolism