GAMT (NM_138924) Human Mass Spec Standard

CAT#: PH316741

GAMT MS Standard C13 and N15-labeled recombinant protein (NP_620279)

Product Images

Coomassie blue staining of purified GAMT protein (Cat# TP316741). The protein was produced from HEK293T cells transfected with GAMT cDNA clone (Cat# RC216741) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216741
• Predicted MW: 29.8 kDa
• Protein Sequence:
  Sequence Link

  >RC216741 representing NM_138924
  Red=Cloning site Green=Tags(s)
  
  MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFG
  MAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLS
  EETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEVRPPEVPHGSPGSDLGWGWE
  GAAGATLLPGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQIA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620279
• RefSeq Size: 1787
• RefSeq ORF: 807
• Synonyms: CCDS2; HEL-S-20; PIG2; TP53I2
• Locus ID: 2593
• UniProt ID: Q14353
• Cytogenetics: 19p13.3
• Summary: 'The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene. Pseudogenes of this gene are found on chromosomes 2 and 13. [provided by RefSeq, Feb 2012]'
• Protein Families: Druggable Genome
• Protein Pathways: Arginine and proline metabolism, Glycine, serine and threonine metabolism, Metabolic pathways