GAMT (NM_000156) Human Recombinant Protein
CAT#: TP721002
Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGSSHHHHHHSSGLVPRGSHMSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTK
|
Tag | N, C-His |
Predicted MW | 29.5 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl,1mM DTT,pH 8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000147 |
Locus ID | 2593 |
UniProt ID | Q14353, V9HWB2 |
Cytogenetics | 19p13.3 |
Refseq Size | 1138 |
Refseq ORF | 708 |
Synonyms | CCDS2; HEL-S-20; PIG2; TP53I2 |
Summary | 'The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene. Pseudogenes of this gene are found on chromosomes 2 and 13. [provided by RefSeq, Feb 2012]' |
Protein Families | Druggable Genome |
Protein Pathways | Arginine and proline metabolism, Glycine, serine and threonine metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408469 | GAMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424896 | GAMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430068 | GAMT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408469 | Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 2 |
USD 325.00 |
|
LY424896 | Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 1 |
USD 325.00 |
|
LY430068 | Transient overexpression lysate of guanidinoacetate N-methyltransferase (GAMT), transcript variant 2 |
USD 325.00 |
|
PH300528 | GAMT MS Standard C13 and N15-labeled recombinant protein (NP_000147) |
USD 2,055.00 |
|
PH316741 | GAMT MS Standard C13 and N15-labeled recombinant protein (NP_620279) |
USD 2,055.00 |
|
TP300528 | Recombinant protein of human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1 |
USD 823.00 |
|
TP316741 | Recombinant protein of human guanidinoacetate N-methyltransferase (GAMT), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review