TMEM97 (NM_014573) Human Mass Spec Standard

CAT#: PH316927

TMEM97 MS Standard C13 and N15-labeled recombinant protein (NP_055388)

Product Images

Coomassie blue staining of purified TMEM97 protein (Cat# TP316927). The protein was produced from HEK293T cells transfected with TMEM97 cDNA clone (Cat# RC216927) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216927
• Predicted MW: 20.8 kDa
• Protein Sequence:
  Sequence Link

  >RC216927 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQEPPAWFKSFL
  FCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLFEDFSKASGFKGQRPETLHER
  LTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055388
• RefSeq Size: 2585
• RefSeq ORF: 528
• Synonyms: MAC30
• Locus ID: 27346
• UniProt ID: Q5BJF2
• Cytogenetics: 17q11.2
• Summary: TMEM97 is a conserved integral membrane protein that plays a role in controlling cellular cholesterol levels (Bartz et al., 2009 [PubMed 19583955]). [supplied by OMIM, Aug 2009]
• Protein Families: Transmembrane