JUND (NM_005354) Human Mass Spec Standard

CAT#: PH316958

JUND MS Standard C13 and N15-labeled recombinant protein (NP_005345)

Product Images

Coomassie blue staining of purified JUND protein (Cat# TP316958). The protein was produced from HEK293T cells transfected with JUND cDNA clone (Cat# RC216958) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216958
• Predicted MW: 35 kDa
• Protein Sequence:
  Sequence Link

  >RC216958 representing NM_005354
  Red=Cloning site Green=Tags(s)
  
  METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPP
  TPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGF
  VKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGA
  ATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRI
  AASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005345
• RefSeq Size: 1891
• RefSeq ORF: 1041
• Synonyms: AP-1
• Locus ID: 3727
• UniProt ID: P17535
• Cytogenetics: 19p13.11
• Summary: The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216). [provided by RefSeq, Nov 2013]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: MAPK signaling pathway