ABHD12 (NM_001042472) Human Mass Spec Standard

CAT#: PH316963

ABHD12 MS Standard C13 and N15-labeled recombinant protein (NP_001035937)

Product Images

Coomassie blue staining of purified ABHD12 protein (Cat# TP316963). The protein was produced from HEK293T cells transfected with ABHD12 cDNA clone (Cat# RC216963) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216963
• Predicted MW: 44.9 kDa
• Protein Sequence:
  Sequence Link

  >RC216963 representing NM_001042472
  Red=Cloning site Green=Tags(s)
  
  MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWL
  RLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGV
  WHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGD
  SVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIRE
  EAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAP
  ARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035937
• RefSeq Size: 1983
• RefSeq ORF: 1194
• Synonyms: ABHD12A; BEM46L2; C20orf22; dJ965G21.2; hABHD12; PHARC
• Locus ID: 26090
• UniProt ID: Q8N2K0
• Cytogenetics: 20p11.21
• Summary: This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2011]
• Protein Families: Protease, Transmembrane