REG3A (NM_138937) Human Mass Spec Standard
CAT#: PH316966
REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620354)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216966 |
Predicted MW | 19.4 kDa |
Protein Sequence |
>RC216966 protein sequence
Red=Cloning site Green=Tags(s) MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQK RPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTI SSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_620354 |
RefSeq Size | 807 |
RefSeq ORF | 525 |
Synonyms | HIP; HIP/PAP; INGAP; PAP; PAP-H; PAP1; PBCGF; REG-III; REG3 |
Locus ID | 5068 |
UniProt ID | Q06141, Q53S56 |
Cytogenetics | 2p12 |
Summary | 'This gene encodes a pancreatic secretory protein that may be involved in cell proliferation or differentiation. It has similarity to the C-type lectin superfamily. The enhanced expression of this gene is observed during pancreatic inflammation and liver carcinogenesis. The mature protein also functions as an antimicrobial protein with antibacterial activity. Alternate splicing results in multiple transcript variants that encode the same protein.[provided by RefSeq, Nov 2014]' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400917 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408477 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408478 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430071 | REG3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400917 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 1 |
USD 396.00 |
|
LY408477 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 3 |
USD 396.00 |
|
LY408478 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 2 |
USD 396.00 |
|
LY430071 | Transient overexpression lysate of regenerating islet-derived 3 alpha (REG3A), transcript variant 2 |
USD 396.00 |
|
PH307791 | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_002571) |
USD 2,055.00 |
|
PH323860 | REG3A MS Standard C13 and N15-labeled recombinant protein (NP_620355) |
USD 2,055.00 |
|
TP307791 | Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 1 |
USD 823.00 |
|
TP316966 | Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 3 |
USD 748.00 |
|
TP323860 | Recombinant protein of human regenerating islet-derived 3 alpha (REG3A), transcript variant 2 |
USD 748.00 |
|
TP701057 | Purified recombinant protein of Human regenerating islet-derived 3 alpha (REG3A), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review