PCYT1B (NM_004845) Human Mass Spec Standard
CAT#: PH316978
PCYT1B MS Standard C13 and N15-labeled recombinant protein (NP_004836)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216978 |
Predicted MW | 41.8 kDa |
Protein Sequence |
>RC216978 representing NM_004845
Red=Cloning site Green=Tags(s) MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLG TPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCR YVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIV RDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEE KSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSS PKAASASISSMSEGDEDEK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004836 |
RefSeq Size | 5447 |
RefSeq ORF | 1107 |
Synonyms | CCTB; CTB |
Locus ID | 9468 |
UniProt ID | Q9Y5K3 |
Cytogenetics | Xp22.11 |
Summary | The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417711 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431289 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431865 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417711 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 1 |
USD 396.00 |
|
LY431289 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 3 |
USD 396.00 |
|
LY431865 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 2 |
USD 396.00 |
|
TP316978 | Recombinant protein of human phosphate cytidylyltransferase 1, choline, beta (PCYT1B) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review