PCYT1B (NM_004845) Human Mass Spec Standard

CAT#: PH316978

PCYT1B MS Standard C13 and N15-labeled recombinant protein (NP_004836)

Product Images

Coomassie blue staining of purified PCYT1B protein (Cat# TP316978). The protein was produced from HEK293T cells transfected with PCYT1B cDNA clone (Cat# RC216978) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC216978
• Predicted MW: 41.8 kDa
• Protein Sequence:
  Sequence Link

  >RC216978 representing NM_004845
  Red=Cloning site Green=Tags(s)
  
  MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLG
  TPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCR
  YVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIV
  RDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEE
  KSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSS
  PKAASASISSMSEGDEDEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004836
• RefSeq Size: 5447
• RefSeq ORF: 1107
• Synonyms: CCTB; CTB
• Locus ID: 9468
• UniProt ID: Q9Y5K3
• Cytogenetics: Xp22.11
• Summary: The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways