Glycophorin C (GYPC) (NM_016815) Human Mass Spec Standard

CAT#: PH317103

GYPC MS Standard C13 and N15-labeled recombinant protein (NP_058131)

Product Images

Coomassie blue staining of purified GYPC protein (Cat# TP317103). The protein was produced from HEK293T cells transfected with GYPC cDNA clone (Cat# RC217103) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217103
• Predicted MW: 11.7 kDa
• Protein Sequence:
  Sequence Link

  >RC217103 representing NM_016815
  Red=Cloning site Green=Tags(s)
  
  MWSTRSPNSTAWPLSLEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKG
  TYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_058131
• RefSeq Size: 1019
• RefSeq ORF: 327
• Synonyms: CD236; CD236R; GE; GE:GPC:GPD:GYPD; GPC; GPD; GYPD; PAS-2; PAS-2'
• Locus ID: 2995
• UniProt ID: P04921
• Cytogenetics: 2q14.3
• Summary: 'Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]'
• Protein Families: Druggable Genome, Transmembrane