AGRP (NM_001138) Human Mass Spec Standard

CAT#: PH317144

AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129)

Product Images

Coomassie blue staining of purified AGRP protein (Cat# TP317144). The protein was produced from HEK293T cells transfected with AGRP cDNA clone (Cat# RC217144) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217144
• Predicted MW: 14.4 kDa
• Protein Sequence:
  Sequence Link

  >RC217144 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQAL
  AEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129
• RefSeq Size: 783
• RefSeq ORF: 396
• Synonyms: AGRT; ART; ASIP2
• Locus ID: 181
• UniProt ID: O00253, C6SUN5
• Cytogenetics: 16q22.1
• Summary: 'This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity. [provided by RefSeq, Dec 2009]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Adipocytokine signaling pathway