POFUT1 (NM_015352) Human Mass Spec Standard

CAT#: PH317185

POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167)

Product Images

Coomassie blue staining of purified POFUT1 protein (Cat# TP317185). The protein was produced from HEK293T cells transfected with POFUT1 cDNA clone (Cat# RC217185) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217185
• Predicted MW: 43.96 kDa
• Protein Sequence:
  Sequence Link

  >RC217185 representing NM_015352
  Red=Cloning site Green=Tags(s)
  
  MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW
  IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC
  PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK
  YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM
  TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF
  IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056167
• RefSeq Size: 5249
• RefSeq ORF: 1164
• Synonyms: DDD2; FUT12; O-Fuc-T; O-FucT-1; O-FUT; OFUCT1
• Locus ID: 23509
• UniProt ID: Q9H488
• Cytogenetics: 20q11.21
• Summary: This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors