POFUT1 (NM_015352) Human Mass Spec Standard
CAT#: PH317185
POFUT1 MS Standard C13 and N15-labeled recombinant protein (NP_056167)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217185 |
Predicted MW | 43.96 kDa |
Protein Sequence |
>RC217185 representing NM_015352
Red=Cloning site Green=Tags(s) MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPW IEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTC PMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQK YMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTM TMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHF IGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_056167 |
RefSeq Size | 5249 |
RefSeq ORF | 1164 |
Synonyms | DDD2; FUT12; O-Fuc-T; O-FucT-1; O-FUT; OFUCT1 |
Locus ID | 23509 |
UniProt ID | Q9H488 |
Cytogenetics | 20q11.21 |
Summary | This gene encodes a member of the glycosyltransferase O-Fuc family. This enzyme adds O-fucose through an O-glycosidic linkage to conserved serine or threonine residues in the epidermal growth factor-like repeats of a number of cell surface and secreted proteins. O-fucose glycans are involved in ligand-induced receptor signaling. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406756 | POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC414612 | POFUT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406756 | Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 2 |
USD 396.00 |
|
LY414612 | Transient overexpression lysate of protein O-fucosyltransferase 1 (POFUT1), transcript variant 1 |
USD 396.00 |
|
TP317185 | Recombinant protein of human protein O-fucosyltransferase 1 (POFUT1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review