Guanylin (GUCA2A) (NM_033553) Human Mass Spec Standard

CAT#: PH317195

GUCA2A MS Standard C13 and N15-labeled recombinant protein (NP_291031)

Product Images

Coomassie blue staining of purified GUCA2A protein (Cat# TP317195). The protein was produced from HEK293T cells transfected with GUCA2A cDNA clone (Cat# RC217195) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217195
• Predicted MW: 12.2 kDa
• Protein Sequence:
  Sequence Link

  >RC217195 representing NM_033553
  Red=Cloning site Green=Tags(s)
  
  MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCS
  NPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_291031
• RefSeq Size: 575
• RefSeq ORF: 345
• Synonyms: GCAP-I; GUCA2; STARA
• Locus ID: 2980
• UniProt ID: Q02747
• Cytogenetics: 1p34.2
• Summary: ''
• Protein Families: Secreted Protein, Transmembrane