BAIAP2 (NM_017451) Human Mass Spec Standard
CAT#: PH317285
BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059345)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217285 |
Predicted MW | 60.7 kDa |
Protein Sequence |
>RC217285 representing NM_017451
Red=Cloning site Green=Tags(s) MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP YSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_059345 |
RefSeq Size | 2877 |
RefSeq ORF | 1656 |
Synonyms | BAP2; FLAF3; IRSP53 |
Locus ID | 10458 |
UniProt ID | Q9UQB8 |
Cytogenetics | 17q25.3 |
Summary | The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401909 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC402587 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC413755 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC429535 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401909 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 3 |
USD 396.00 |
|
LY402587 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 1 |
USD 396.00 |
|
LY413755 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 |
USD 605.00 |
|
LY429535 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 |
USD 396.00 |
|
PH304233 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059344) |
USD 2,055.00 |
|
PH314570 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_006331) |
USD 2,055.00 |
|
TP304233 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1 |
USD 867.00 |
|
TP314570 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 3 |
USD 748.00 |
|
TP317285 | Purified recombinant protein of Homo sapiens BAI1-associated protein 2 (BAIAP2), transcript variant 2 |
USD 748.00 |
|
TP710123 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review