Kallikrein 5 (KLK5) (NM_001077491) Human Mass Spec Standard

CAT#: PH317479

KLK5 MS Standard C13 and N15-labeled recombinant protein (NP_001070959)

Product Images

Coomassie blue staining of purified KLK5 protein (Cat# TP317479). The protein was produced from HEK293T cells transfected with KLK5 cDNA clone (Cat# RC217479) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217479
• Predicted MW: 32 kDa
• Protein Sequence:
  Sequence Link

  >RC217479 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATARPPWMWVLCALITALLLGVTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIING
  SDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSI
  PHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNIS
  VLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCK
  FTKWIQETIQANS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001070959
• RefSeq Size: 1435
• RefSeq ORF: 879
• Synonyms: KLK-L2; KLKL2; SCTE
• Locus ID: 25818
• UniProt ID: Q9Y337
• Cytogenetics: 19q13.41
• Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its expression is up-regulated by estrogens and progestins. The encoded protein is secreted and may be involved in desquamation in the epidermis. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Protease, Secreted Protein, Transmembrane