ACSL3 (NM_203372) Human Mass Spec Standard
CAT#: PH317537
ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_976251)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217537 |
Predicted MW | 80.2 kDa |
Protein Sequence |
>RC217537 representing NM_203372
Red=Cloning site Green=Tags(s) MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPVNSKPDSAYRS VNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDV FVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNI ITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSD IAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIG YSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQI SKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVW DYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWL CTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQK ELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL KRKELKTHYQADIERMYGRK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_976251 |
RefSeq Size | 4262 |
RefSeq ORF | 2160 |
Synonyms | ACS3; FACL3; LACS 3; LACS3; PRO2194 |
Locus ID | 2181 |
UniProt ID | O95573, A0A024R487 |
Cytogenetics | 2q36.1 |
Summary | 'The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Transmembrane |
Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403709 | ACSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC417974 | ACSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403709 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2 |
USD 325.00 |
|
LY417974 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1 |
USD 325.00 |
|
PH308032 | ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_004448) |
USD 2,055.00 |
|
TP308032 | Recombinant protein of human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1 |
USD 823.00 |
|
TP317537 | Recombinant protein of human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review