SYTL2 (NM_032943) Human Mass Spec Standard
CAT#: PH317584
SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_116561)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217584 |
Predicted MW | 102.4 kDa |
Protein Sequence |
>RC217584 representing NM_032943
Red=Cloning site Green=Tags(s) MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGAD IIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSV IDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTS IQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSS STDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHG REVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGL HSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEE EPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDDEKPDQKPVTNECVPRISTVPT QPDNPFSHPDKLKRMSKSVPAFLQDEVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKD LAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTF KRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEV HIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVEL TVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_116561 |
RefSeq Size | 3985 |
RefSeq ORF | 2733 |
Synonyms | CHR11SYT; EXO4; PPP1R151; SGA72M; SLP2; SLP2A |
Locus ID | 54843 |
UniProt ID | Q9HCH5 |
Cytogenetics | 11q14.1 |
Summary | The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jun 2009] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403206 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC404177 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404178 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC410172 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429805 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430962 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430963 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403206 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant a |
USD 605.00 |
|
LY404177 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant e |
USD 396.00 |
|
LY404178 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant f |
USD 396.00 |
|
LY410172 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant b |
USD 396.00 |
|
LY429805 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant b |
USD 396.00 |
|
LY430962 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant e |
USD 396.00 |
|
LY430963 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant f |
USD 396.00 |
|
PH317701 | SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_996812) |
USD 2,055.00 |
|
PH318076 | SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_115755) |
USD 2,055.00 |
|
TP317584 | Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant a |
USD 788.00 |
|
TP317701 | Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant e |
USD 748.00 |
|
TP318076 | Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant b |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review