SYTL2 (NM_206929) Human Mass Spec Standard

CAT#: PH317701

SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_996812)

Product Images

Coomassie blue staining of purified SYTL2 protein (Cat# TP317701). The protein was produced from HEK293T cells transfected with SYTL2 cDNA clone (Cat# RC217701) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217701
• Predicted MW: 42.6 kDa
• Protein Sequence:
  Sequence Link

  >RC217701 representing NM_206929
  Red=Cloning site Green=Tags(s)
  
  MSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEV
  KGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNE
  ILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAEN
  RGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKT
  TNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWE
  KMVNSPNTWIEATLPLRMLLIAKISK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996812
• RefSeq Size: 2447
• RefSeq ORF: 1128
• Synonyms: CHR11SYT; EXO4; PPP1R151; SGA72M; SLP2; SLP2A
• Locus ID: 54843
• UniProt ID: Q9HCH5
• Cytogenetics: 11q14.1
• Summary: The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jun 2009]