WIPF1 (NM_003387) Human Mass Spec Standard
CAT#: PH317601
WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_003378)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217601 |
Predicted MW | 51.1 kDa |
Protein Sequence |
>RC217601 representing NM_003387
Red=Cloning site Green=Tags(s) MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGG GGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKP FSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSLHNRGSPPVPGGP RQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHRE AVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPS PGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNR RERGAPPLPPIPR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003378 |
RefSeq Size | 4605 |
RefSeq ORF | 1509 |
Synonyms | PRPL-2; WAS2; WASPIP; WIP |
Locus ID | 7456 |
UniProt ID | O43516, A0A140VJZ9, Q2YDC4 |
Cytogenetics | 2q31.1 |
Summary | 'This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401163 | WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421397 | WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY401163 | Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1 |
USD 605.00 |
|
LY421397 | Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2 |
USD 605.00 |
|
PH312019 | WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001070737) |
USD 2,055.00 |
|
TP312019 | Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2 |
USD 788.00 |
|
TP317601 | Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review