NCAPH2 (NM_014551) Human Mass Spec Standard

CAT#: PH317604

NCAPH2 MS Standard C13 and N15-labeled recombinant protein (NP_055366)

Product Images

Coomassie blue staining of purified NCAPH2 protein (Cat# TP317604). The protein was produced from HEK293T cells transfected with NCAPH2 cDNA clone (Cat# RC217604) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217604
• Predicted MW: 32.6 kDa
• Protein Sequence:
  Sequence Link

  >RC217604 representing NM_014551
  Red=Cloning site Green=Tags(s)
  
  MEDVEARFAHLLQPIRDLTKNWEVDVAAQLGEYLEELDQICISFDEGKTTMNFIEAALLIQGSACVYSKK
  VEYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPS
  EVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMSPMEPAGVSPM
  PGTQKDTGRTEEQPMEVSVCRSPVPALGFSQEPGPSPEGPMPLGGGEDEDAEEAVELPEASAPKAALEPK
  ESRSPQQVGPTWRPAEPEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055366
• RefSeq Size: 1440
• RefSeq ORF: 897
• Synonyms: CAPH2
• Locus ID: 29781
• UniProt ID: Q6IBW4
• Cytogenetics: 22q13.33
• Summary: This gene encodes one of the non-SMC subunits of the condensin II complex. This complex plays an essential role in mitotic chromosome assembly. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, May 2010]