HMX1 (NM_018942) Human Mass Spec Standard

CAT#: PH317611

HMX1 MS Standard C13 and N15-labeled recombinant protein (NP_061815)

Product Images

Coomassie blue staining of purified HMX1 protein (Cat# TP317611). The protein was produced from HEK293T cells transfected with HMX1 cDNA clone (Cat# RC217611) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217611
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC217611 representing NM_018942
  Red=Cloning site Green=Tags(s)
  
  MPDELTEPGRATPARASSFLIENLLAAEAKGAGRATQGDGSREDEEEDDDDPEDEDAEQARRRRLQRRRQ
  LLAGTGPGGEARARALLGPGALGLGPRPPPGPGPPFALGCGGAARWYPRAHGGYGGGLSPDTSDRDSPET
  GEEMGRAEGAWPRGPGPGAVQREAAELAARGPAAGTEEASELAEVPAAAGETRGGVGVGGGRKKKTRTVF
  SRSQVFQLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLV
  RVPVLYHESPPAAAAAGPPATLPFPLAPAAPAPPPPLLGFSGALAYPLAAFPAAASVPFLRAQMPGLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061815
• RefSeq Size: 1884
• RefSeq ORF: 1044
• Synonyms: H6; NKX5-3
• Locus ID: 3166
• UniProt ID: Q9NP08
• Cytogenetics: 4p16.1
• Summary: 'This gene encodes a transcription factor that belongs to the H6 family of homeobox proteins. This protein can bind a 5'-CAAG-3' core DNA sequence, and it is involved in the development of craniofacial structures. Mutations in this gene cause oculoauricular syndrome, a disorder of the eye and external ear. [provided by RefSeq, Oct 2009]'