PYK2 (PTK2B) (NM_173175) Human Mass Spec Standard
CAT#: PH317684
PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_775267)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217684 |
| Predicted MW | 111 kDa |
| Protein Sequence |
>RC217684 representing NM_173175
Red=Cloning site Green=Tags(s) MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVKCTVQTEIREI ITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWRYDLQIRYLPEDF MESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFKDMPHNALDKKSNFELLEKEVGL DLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLV IGPKGIRQLTSQDAKPTCLAEFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDG YCRLQGEHQGSLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKNLDHPHIVKLI GIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYLESINCVHRDIAVRNILVASP ECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLE NKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYR TPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQEEDFIQPSSREEAQQLWEAEKVKMRQILDKQQ KQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYL NVMELVWAVLELKNELCQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAE LINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_775267 |
| RefSeq Size | 3936 |
| RefSeq ORF | 2901 |
| Synonyms | CADTK; CAKB; FADK2; FAK2; PKB; PTK; PYK2; RAFTK |
| Locus ID | 2185 |
| UniProt ID | Q14289 |
| Cytogenetics | 8p21.2 |
| Summary | This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Calcium signaling pathway, Chemokine signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401325 | PTK2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC406631 | PTK2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC406632 | PTK2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC430386 | PTK2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY401325 | Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 2 |
USD 436.00 |
|
| LY406631 | Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 1 |
USD 436.00 |
|
| LY406632 | Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 4 |
USD 665.00 |
|
| LY430386 | Transient overexpression lysate of PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 4 |
USD 605.00 |
|
| PH303808 | PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_004094) |
USD 2,055.00 |
|
| PH305372 | PTK2B MS Standard C13 and N15-labeled recombinant protein (NP_775266) |
USD 2,055.00 |
|
| TP303808 | Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 2 |
USD 867.00 |
|
| TP305372 | Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 1 |
USD 823.00 |
|
| TP317684 | Recombinant protein of human PTK2B protein tyrosine kinase 2 beta (PTK2B), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China