Tau (MAPT) (NM_016834) Human Mass Spec Standard
CAT#: PH317773
MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058518)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217773 |
| Predicted MW | 39.8 kDa |
| Protein Sequence |
>RC217773 representing NM_016834
Red=Cloning site Green=Tags(s) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMV SKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYS SPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKH QPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVE VKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHL SNVSSTGSIDMVDSPQLATLADEVSASLAKQGL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_058518 |
| RefSeq Size | 5557 |
| RefSeq ORF | 1149 |
| Synonyms | DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU |
| Locus ID | 4137 |
| UniProt ID | P10636, A0A024R9Y0 |
| Cytogenetics | 17q21.31 |
| Summary | 'This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, MAPK signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401790 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC413819 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC413820 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC413823 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426599 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429527 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY401790 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 2 |
USD 665.00 |
|
| LY413819 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 3 |
USD 436.00 |
|
| LY413820 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 |
USD 665.00 |
|
| LY413823 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 4 |
USD 436.00 |
|
| LY426599 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 5 |
USD 436.00 |
|
| LY429527 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 |
USD 605.00 |
|
| PH313312 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_005901) |
USD 2,055.00 |
|
| PH313364 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525) |
USD 2,055.00 |
|
| TP313312 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 2 |
USD 867.00 |
|
| TP313364 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 4 |
USD 748.00 |
|
| TP317773 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 3 |
USD 748.00 |
|
| TP720155 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 6 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China