PTBP1 (NM_031990) Human Mass Spec Standard
CAT#: PH317785
PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_114367)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217785 |
| Predicted MW | 58.9 kDa |
| Protein Sequence |
>RC217785 representing NM_031990
Red=Cloning site Green=Tags(s) MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDV TEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDS SPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTV LKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDL PSGDSQPSLDQTMAAAFASPYAGAGFPPTFAIPQAAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGL AGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHG KPIRITLSKHQNVQLPREGQEDQGLTKDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLK VLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_114367 |
| RefSeq Size | 3300 |
| RefSeq ORF | 1650 |
| Synonyms | HNRNP-I; HNRNPI; HNRPI; pPTB; PTB; PTB-1; PTB-T; PTB2; PTB3; PTB4 |
| Locus ID | 5725 |
| UniProt ID | P26599 |
| Cytogenetics | 19p13.3 |
| Summary | 'This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410400 | PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC410401 | PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419090 | PTBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY410400 | Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 2 |
USD 436.00 |
|
| LY410401 | Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 3 |
USD 436.00 |
|
| LY419090 | Transient overexpression lysate of polypyrimidine tract binding protein 1 (PTBP1), transcript variant 1 |
USD 436.00 |
|
| PH301779 | PTBP1 MS Standard C13 and N15-labeled recombinant protein (NP_002810) |
USD 2,055.00 |
|
| TP301779 | Recombinant protein of human polypyrimidine tract binding protein 1 (PTBP1), transcript variant 1 |
USD 823.00 |
|
| TP317785 | Recombinant protein of human polypyrimidine tract binding protein 1 (PTBP1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China