MIA40 (CHCHD4) (NM_001098502) Human Mass Spec Standard

CAT#: PH317831

CHCHD4 MS Standard C13 and N15-labeled recombinant protein (NP_001091972)

Product Images

Coomassie blue staining of purified CHCHD4 protein (Cat# TP317831). The protein was produced from HEK293T cells transfected with CHCHD4 cDNA clone (Cat# RC217831) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217831
• Predicted MW: 15.8 kDa
• Protein Sequence:
  Sequence Link

  >RC217831 representing NM_001098502
  Red=Cloning site Green=Tags(s)
  
  MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKS
  AFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEG
  SS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001091972
• RefSeq Size: 1476
• RefSeq ORF: 426
• Synonyms: MIA40; TIMM40
• Locus ID: 131474
• UniProt ID: Q8N4Q1, A0A024R2I5
• Cytogenetics: 3p25.1
• Summary: CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]). [supplied by OMIM, Mar 2008]