SNF5 (SMARCB1) (NM_001007468) Human Mass Spec Standard

CAT#: PH317885

SMARCB1 MS Standard C13 and N15-labeled recombinant protein (NP_001007469)

Product Images

Coomassie blue staining of purified SMARCB1 protein (Cat# TP317885). The protein was produced from HEK293T cells transfected with SMARCB1 cDNA clone (Cat# RC217885) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217885
• Predicted MW: 43.2 kDa
• Protein Sequence:
  Sequence Link

  >RC217885 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDH
  GYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCST
  TINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFS
  EILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENS
  PEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDA
  EMEKKIRDQDRNTRRMRRLANTAPAW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007469
• RefSeq Size: 1690
• RefSeq ORF: 1128
• Synonyms: BAF47; CSS3; hSNFS; INI1; MRD15; PPP1R144; RDT; RTPS1; Sfh1p; SNF5; SNF5L1; Snr1; SWNTS1
• Locus ID: 6598
• UniProt ID: Q12824
• Cytogenetics: 22q11
• Summary: 'The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]'
• Protein Families: Transcription Factors