RAB27A (NM_183234) Human Mass Spec Standard

CAT#: PH317900

RAB27A MS Standard C13 and N15-labeled recombinant protein (NP_899057)

Product Images

Coomassie blue staining of purified RAB27A protein (Cat# TP317900). The protein was produced from HEK293T cells transfected with RAB27A cDNA clone (Cat# RC217900) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217900
• Predicted MW: 24.9 kDa
• Protein Sequence:
  Sequence Link

  >RC217900 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL
  QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ
  RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL
  SEEKEKGACGC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_899057
• RefSeq Size: 3455
• RefSeq ORF: 663
• Synonyms: GS2; HsT18676; RAB27; RAM
• Locus ID: 5873
• UniProt ID: P51159, A2RU94
• Cytogenetics: 15q21.3
• Summary: 'The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome