Myosin Phosphatase 2 (PPP1R12B) (NM_032104) Human Mass Spec Standard

CAT#: PH317905

PPP1R12B MS Standard C13 and N15-labeled recombinant protein (NP_115287)

Product Images

Coomassie blue staining of purified PPP1R12B protein (Cat# TP317905). The protein was produced from HEK293T cells transfected with PPP1R12B cDNA clone (Cat# RC217905) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217905
• Predicted MW: 26.1 kDa
• Protein Sequence:
  Sequence Link

  >RC217905 representing NM_032104
  Red=Cloning site Green=Tags(s)
  
  MDKNENEEADLDEQSSKRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESGGSNP
  TTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKLQEAQLELADIKSKL
  EKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKNLHQLKQIQTLKQMNEQLQAENRALTRVVA
  RLSESIESSDTQEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115287
• RefSeq Size: 2227
• RefSeq ORF: 672
• Synonyms: MYPT2; PP1bp55
• Locus ID: 4660
• UniProt ID: O60237
• Cytogenetics: 1q32.1
• Summary: 'Myosin phosphatase is a protein complex comprised of three subunits: a catalytic subunit (PP1c-delta, protein phosphatase 1, catalytic subunit delta), a large regulatory subunit (MYPT, myosin phosphatase target) and small regulatory subunit (sm-M20). Two isoforms of MYPT have been isolated--MYPT1 and MYPT2, the first of which is widely expressed, and the second of which may be specific to heart, skeletal muscle, and brain. Each of the MYPT isoforms functions to bind PP1c-delta and increase phosphatase activity. This locus encodes both MYTP2 and M20. Alternatively spliced transcript variants encoding different isoforms have been identified. Related pseudogenes have been defined on the Y chromosome. [provided by RefSeq, Oct 2011]'
• Protein Families: Druggable Genome
• Protein Pathways: Vascular smooth muscle contraction