IRF7 (NM_001572) Human Mass Spec Standard
CAT#: PH317934
IRF7 MS Standard C13 and N15-labeled recombinant protein (NP_001563)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217934 |
| Predicted MW | 54.1 kDa |
| Protein Sequence |
>RC217934 representing NM_001572
Red=Cloning site Green=Tags(s) MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRW PPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTE AEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKA PGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTA VQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELL RHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYD DIECFLMELEQPASGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001563 |
| RefSeq Size | 1890 |
| RefSeq ORF | 1916 |
| Synonyms | IMD39; IRF-7; IRF-7H; IRF7A; IRF7B; IRF7C; IRF7H |
| Locus ID | 3665 |
| UniProt ID | Q92985 |
| Cytogenetics | 11p15.5 |
| Summary | 'IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. Multiple IRF7 transcript variants have been identified, although the functional consequences of these have not yet been established. [provided by RefSeq, Jul 2008]' |
| Protein Families | Transcription Factors |
| Protein Pathways | Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400601 | IRF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC418288 | IRF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429178 | IRF7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400601 | Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant a |
USD 665.00 |
|
| LY418288 | Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant d |
USD 665.00 |
|
| LY429178 | Transient overexpression lysate of interferon regulatory factor 7 (IRF7), transcript variant d |
USD 396.00 |
|
| TP317934 | Recombinant protein of human interferon regulatory factor 7 (IRF7), transcript variant a |
USD 788.00 |
|
| TP761223 | Purified recombinant protein of Human interferon regulatory factor 7 (IRF7), transcript variant a, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China