PTP4A3 (NM_007079) Human Mass Spec Standard

CAT#: PH317944

PTP4A3 MS Standard C13 and N15-labeled recombinant protein (NP_009010)

Product Images

Coomassie blue staining of purified PTP4A3 protein (Cat# TP317944). The protein was produced from HEK293T cells transfected with PTP4A3 cDNA clone (Cat# RC217944) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC217944
• Predicted MW: 16.6 kDa
• Protein Sequence:
  Sequence Link

  >RC217944 representing NM_007079
  Red=Cloning site Green=Tags(s)
  
  MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPF
  DDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHT
  HKTRCCVM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009010
• RefSeq Size: 1321
• RefSeq ORF: 444
• Synonyms: PRL-3; PRL-R; PRL3
• Locus ID: 11156
• UniProt ID: O75365
• Cytogenetics: 8q24.3
• Summary: This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Phosphatase