BAF53A (ACTL6A) (NM_004301) Human Mass Spec Standard
CAT#: PH317977
ACTL6A MS Standard C13 and N15-labeled recombinant protein (NP_004292)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217977 |
Predicted MW | 43.25 kDa |
Protein Sequence |
>RC217977 representing NM_004301
Red=Cloning site Green=Tags(s) MVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVK SEASLHPVLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPV HDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIATKEAVREGSPANWKRKEKLPQVTRSWHN YMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTM LGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFS SWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004292 |
RefSeq Size | 1879 |
RefSeq ORF | 1161 |
Synonyms | ACTL6; Arp4; ARPN-BETA; BAF53A; INO80K |
Locus ID | 86 |
UniProt ID | O96019 |
Cytogenetics | 3q26.33 |
Summary | 'This gene encodes a family member of actin-related proteins (ARPs), which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a 53 kDa subunit protein of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. Together with beta-actin, it is required for maximal ATPase activity of BRG1, and for the association of the BAF complex with chromatin/matrix. Three transcript variants that encode two different protein isoforms have been described. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406030 | ACTL6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC406076 | ACTL6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418091 | ACTL6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430490 | ACTL6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406030 | Transient overexpression lysate of actin-like 6A (ACTL6A), transcript variant 3 |
USD 396.00 |
|
LY406076 | Transient overexpression lysate of actin-like 6A (ACTL6A), transcript variant 2 |
USD 396.00 |
|
LY418091 | Transient overexpression lysate of actin-like 6A (ACTL6A), transcript variant 1 |
USD 396.00 |
|
LY430490 | Transient overexpression lysate of actin-like 6A (ACTL6A), transcript variant 3 |
USD 396.00 |
|
TP317977 | Recombinant protein of human actin-like 6A (ACTL6A), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review