XRCC4 (NM_022550) Human Mass Spec Standard

CAT#: PH318029

XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_072044)

Product Images

Coomassie blue staining of purified XRCC4 protein (Cat# TP318029). The protein was produced from HEK293T cells transfected with XRCC4 cDNA clone (Cat# RC218029) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218029
• Predicted MW: 37.9 kDa
• Protein Sequence:
  Sequence Link

  >RC218029 representing NM_022550
  Red=Cloning site Green=Tags(s)
  
  MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL
  RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK
  NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK
  QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL
  GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_072044
• RefSeq Size: 1707
• RefSeq ORF: 1008
• Synonyms: SSMED
• Locus ID: 7518
• UniProt ID: Q13426, A0A024RAL0, Q7Z763
• Cytogenetics: 5q14.2
• Summary: 'The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. [provided by RefSeq, Oct 2019]'
• Protein Families: Druggable Genome
• Protein Pathways: Non-homologous end-joining