XRCC4 (NM_022550) Human Mass Spec Standard
CAT#: PH318029
XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_072044)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218029 |
Predicted MW | 37.9 kDa |
Protein Sequence |
>RC218029 representing NM_022550
Red=Cloning site Green=Tags(s) MERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMAMEKGKYVGEL RKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPAEVIRELICYCLDTIAENQAK NEHLQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRSLHNKLLNAAQEREKDIK QEGETAICSEMTADRDPVYDESTDEESENQTDLSGLASAAVSKDDSIISSLDVTDIAPSRKRRQRMQRNL GTEPKMAPQENQLQEKENSRPDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_072044 |
RefSeq Size | 1707 |
RefSeq ORF | 1008 |
Synonyms | SSMED |
Locus ID | 7518 |
UniProt ID | Q13426, A0A024RAL0, Q7Z763 |
Cytogenetics | 5q14.2 |
Summary | 'The protein encoded by this gene functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand breaks. This protein plays a role in both non-homologous end joining and the completion of V(D)J recombination. Mutations in this gene can cause short stature, microcephaly, and endocrine dysfunction (SSMED). Alternate transcript variants such as NM_022406 are unlikely to be expressed in some individuals due to a polymorphism (rs1805377) in the last splice acceptor site. [provided by RefSeq, Oct 2019]' |
Protein Families | Druggable Genome |
Protein Pathways | Non-homologous end-joining |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402930 | XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC418718 | XRCC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402930 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 |
USD 325.00 |
|
LY418718 | Transient overexpression lysate of X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1 |
USD 325.00 |
|
PH312684 | XRCC4 MS Standard C13 and N15-labeled recombinant protein (NP_003392) |
USD 2,055.00 |
|
TP312684 | Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 1 |
USD 748.00 |
|
TP318029 | Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 4 (XRCC4), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review