HHLA3 (NM_007071) Human Mass Spec Standard

CAT#: PH318069

HHLA3 MS Standard C13 and N15-labeled recombinant protein (NP_009002)

Product Images

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218069
• Predicted MW: 8.5 kDa
• Protein Sequence:
  Sequence Link

  >RC218069 representing NM_007071
  Red=Cloning site Green=Tags(s)
  
  MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAVLSTERGPYPDPKRAFLD
  LLQERI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009002
• RefSeq Size: 834
• RefSeq ORF: 228
• Synonyms: HERV-H LTR-associating 3; human endogenous retrovirus-H long terminal repeat-associating 3; OTTHUMP00000010943
• Locus ID: 11147
• Cytogenetics: 1p31.1