mu Crystallin (CRYM) (NM_001888) Human Mass Spec Standard

CAT#: PH318123

CRYM MS Standard C13 and N15-labeled recombinant protein (NP_001879)

Product Images

Coomassie blue staining of purified CRYM protein (Cat# TP318123). The protein was produced from HEK293T cells transfected with CRYM cDNA clone (Cat# RC218123) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218123
• Predicted MW: 33.8 kDa
• Protein Sequence:
  Sequence Link

  >RC218123 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAED
  ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLC
  ILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEP
  ILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVK
  PAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001879
• RefSeq Size: 1559
• RefSeq ORF: 942
• Synonyms: DFNA40; THBP
• Locus ID: 1428
• UniProt ID: Q14894
• Cytogenetics: 16p12.2
• Summary: 'Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Mutations in this gene have been associated with autosomal dominant non-syndromic deafness. [provided by RefSeq, Sep 2014]'