CD14 (NM_001040021) Human Mass Spec Standard
CAT#: PH318181
CD14 MS Standard C13 and N15-labeled recombinant protein (NP_001035110)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218181 |
| Predicted MW | 40.1 kDa |
| Protein Sequence |
>RC218181 protein sequence
Red=Cloning site Green=Tags(s) MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFL KRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEAT GLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGER GLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNS LNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP ACARSTLSVGVSGTLVLLQGARGFA myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001035110 |
| RefSeq Size | 1561 |
| RefSeq ORF | 1125 |
| Synonyms | CD14 antigen; CD14 molecule; monocyte differentiation antigen CD14 |
| Locus ID | 929 |
| UniProt ID | P08571 |
| Cytogenetics | 5q31.3 |
| Summary | 'The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Aug 2020]' |
| Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transmembrane |
| Protein Pathways | Hematopoietic cell lineage, MAPK signaling pathway, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Toll-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421877 | CD14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC424624 | CD14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY421877 | Transient overexpression lysate of CD14 molecule (CD14), transcript variant 2 |
USD 436.00 |
|
| LY424624 | Transient overexpression lysate of CD14 molecule (CD14), transcript variant 1 |
USD 436.00 |
|
| PH303819 | CD14 MS Standard C13 and N15-labeled recombinant protein (NP_000582) |
USD 2,055.00 |
|
| TP303819 | Recombinant protein of human CD14 molecule (CD14), transcript variant 1 |
USD 823.00 |
|
| TP318181 | Recombinant protein of human CD14 molecule (CD14), transcript variant 2 |
USD 748.00 |
|
| TP700277 | Purified recombinant protein of human CD14 molecule (CD14), transcript variant 1, with C-terminal Fc tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP720276 | Recombinant protein of human CD14 molecule (CD14), transcript variant 1 |
USD 330.00 |
|
| TP723389 | Purified recombinant protein of Human CD14 molecule (CD14), transcript variant 1. |
USD 140.00 |
|
| TP723883 | Purified recombinant protein of Human CD14 molecule (CD14), transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China