SOX1 (NM_005986) Human Mass Spec Standard

CAT#: PH318236

SOX1 MS Standard C13 and N15-labeled recombinant protein (NP_005977)

Product Images

Coomassie blue staining of purified SOX1 protein (Cat# TP318236). The protein was produced from HEK293T cells transfected with SOX1 cDNA clone (Cat# RC218236) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218236
• Predicted MW: 38.8 kDa
• Protein Sequence:
  Sequence Link

  >RC218236 representing NM_005986
  Red=Cloning site Green=Tags(s)
  
  MYSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRVKRPMNAFMVWSRGQRRKMA
  QENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLLKKDKYSLAGG
  LLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGGYAHVNGWANGAYPGSVAAAAAAAAMMQEAQ
  LAYGQHPGAGGAHPHAHPAHPHPHHPHAHPHNPQPMHRYDMGALQYSPISNSQGYMSASPSGYGGLPYGA
  AAAAAAAAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPA
  GEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005977
• RefSeq Size: 4108
• RefSeq ORF: 1173
• Synonyms: SRY (sex determining region Y)-box 1; SRY-related HMG-box gene 1
• Locus ID: 6656
• UniProt ID: O00570
• Cytogenetics: 13q34
• Summary: 'This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. In mice, a similar protein regulates the gamma-crystallin genes and is essential for lens development. [provided by RefSeq, Jul 2008]'
• Protein Families: Adult stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transmembrane