PRPF31 (NM_015629) Human Mass Spec Standard

CAT#: PH318307

PRPF31 MS Standard C13 and N15-labeled recombinant protein (NP_056444)

Product Images

Coomassie blue staining of purified PRPF31 protein (Cat# TP318307). The protein was produced from HEK293T cells transfected with PRPF31 cDNA clone (Cat# RC218307) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218307
• Predicted MW: 55.3 kDa
• Protein Sequence:
  Sequence Link

  >RC218307 representing NM_015629
  Red=Cloning site Green=Tags(s)
  
  MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEY
  ISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVK
  ELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVES
  RMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIV
  QSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQ
  RKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARI
  SKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVK
  GEKSGLMST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056444
• RefSeq Size: 2153
• RefSeq ORF: 1497
• Synonyms: NY-BR-99; PRP31; RP11; SNRNP61
• Locus ID: 26121
• UniProt ID: Q8WWY3
• Cytogenetics: 19q13.42
• Summary: This gene encodes a component of the spliceosome complex and is one of several retinitis pigmentosa-causing genes. When the gene product is added to the spliceosome complex, activation occurs. [provided by RefSeq, Jan 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome