RAD51 (NM_002875) Human Mass Spec Standard
CAT#: PH318333
RAD51 MS Standard C13 and N15-labeled recombinant protein (NP_002866)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC218333 |
| Predicted MW | 36.8 kDa |
| Protein Sequence |
>RC218333 representing NM_002875
Red=Cloning site Green=Tags(s) MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTL AVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAM MVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFA ADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002866 |
| RefSeq Size | 2254 |
| RefSeq ORF | 1017 |
| Synonyms | BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA |
| Locus ID | 5888 |
| UniProt ID | Q06609 |
| Cytogenetics | 15q15.1 |
| Summary | 'The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]' |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Homologous recombination, Pancreatic cancer, Pathways in cancer |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408818 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419044 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429121 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC431240 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC431300 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY408818 | Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 2 |
USD 436.00 |
|
| LY419044 | Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1 |
USD 436.00 |
|
| LY429121 | Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1 |
USD 396.00 |
|
| LY431240 | Transient overexpression lysate of RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 3 |
USD 436.00 |
|
| LY431300 | Transient overexpression lysate of RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 4 |
USD 436.00 |
|
| TP318333 | Recombinant protein of human RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China