SNRPC (NM_003093) Human Mass Spec Standard

CAT#: PH318418

SNRPC MS Standard C13 and N15-labeled recombinant protein (NP_003084)

Product Images

Coomassie blue staining of purified SNRPC protein (Cat# TP318418). The protein was produced from HEK293T cells transfected with SNRPC cDNA clone (Cat# RC218418) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC218418
• Predicted MW: 17.2 kDa
• Protein Sequence:
  Sequence Link

  >RC218418 representing NM_003093
  Red=Cloning site Green=Tags(s)
  
  MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP
  PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR
  PPARPMMVPTRPGMTRPDR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003084
• RefSeq Size: 733
• RefSeq ORF: 477
• Synonyms: U1C; Yhc1
• Locus ID: 6631
• UniProt ID: P09234, Q5TAL4
• Cytogenetics: 6p21.31
• Summary: 'This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.[provided by RefSeq, Oct 2009]'
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome